PDB entry 4yjx

View 4yjx on RCSB PDB site
Description: The stucture of Agrobacterium tumefaciens ClpS2 bound to L-phenylalaninamide
Class: protein binding
Keywords: N-end rule, Protease adaptor, PROTEIN BINDING
Deposited on 2015-03-03, released 2016-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adapter protein ClpS 2
    Species: Agrobacterium fabrum (strain C58 / ATCC 33970) [TaxId:176299]
    Gene: clpS2, Atu2232, AGR_C_4060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yjxa_
  • Chain 'B':
    Compound: ATP-dependent Clp protease adapter protein ClpS 2
    Species: Agrobacterium fabrum (strain C58 / ATCC 33970) [TaxId:176299]
    Gene: clpS2, Atu2232, AGR_C_4060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yjxb_
  • Chain 'C':
    Compound: ATP-dependent Clp protease adapter protein ClpS 2
    Species: Agrobacterium fabrum (strain C58 / ATCC 33970) [TaxId:176299]
    Gene: clpS2, Atu2232, AGR_C_4060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yjxc_
  • Chain 'D':
    Compound: ATP-dependent Clp protease adapter protein ClpS 2
    Species: Agrobacterium fabrum (strain C58 / ATCC 33970) [TaxId:176299]
    Gene: clpS2, Atu2232, AGR_C_4060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yjxd_
  • Heterogens: SO4, NFA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yjxA (A:)
    msdspvdlkpkpkvkpklerpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmt
    ahrfgsavvvvcerdiaetkakeatdlgkeagfplmfttepee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yjxA (A:)
    rpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmtahrfgsavvvvcerdiaet
    kakeatdlgkeagfplmfttepe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yjxB (B:)
    msdspvdlkpkpkvkpklerpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmt
    ahrfgsavvvvcerdiaetkakeatdlgkeagfplmfttepee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yjxB (B:)
    rpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmtahrfgsavvvvcerdiaet
    kakeatdlgkeagfplmfttepe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yjxC (C:)
    msdspvdlkpkpkvkpklerpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmt
    ahrfgsavvvvcerdiaetkakeatdlgkeagfplmfttepee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yjxC (C:)
    rpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmtahrfgsavvvvcerdiaet
    kakeatdlgkeagfplmfttepee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4yjxD (D:)
    msdspvdlkpkpkvkpklerpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmt
    ahrfgsavvvvcerdiaetkakeatdlgkeagfplmfttepee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yjxD (D:)
    rpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmtahrfgsavvvvcerdiaet
    kakeatdlgkeagfplmfttepe