PDB entry 4yjv

View 4yjv on RCSB PDB site
Description: the kinase domain of human spleen tyrosine (syk) in complex with gtc000250
Class: transferase
Keywords: syk, non-receptor tyrosine kinase, spleen tyrosine kinase, transferase, phosphorylation, transferase-transferase inhibitor complex
Deposited on 2015-03-03, released 2015-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yjva_
  • Heterogens: 4DT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yjvA (A:)
    peeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalk
    dellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniiel
    vhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkw
    pvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcp
    agcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yjvA (A:)
    yldrklltledkelgtvkkgyyqmkkvvktvavkilkneandpalkdellaeanvmqqld
    npyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylees
    nfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyyk
    fssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlc
    wtydvenrpgfaavelrlrnyyydv