PDB entry 4yip

View 4yip on RCSB PDB site
Description: X-ray structure of the iron/manganese cambialistic superoxide dismutase from Streptococcus mutans
Class: oxidoreductase
Keywords: oxidoreductase, cambialistic
Deposited on 2015-03-02, released 2016-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn/Fe]
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09738 (Start-201)
      • expression tag (202-203)
    Domains in SCOPe 2.05: d4yipa1, d4yipa2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn/Fe]
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09738 (Start-201)
      • expression tag (202-203)
    Domains in SCOPe 2.05: d4yipb1, d4yipb2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn/Fe]
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4yipc1, d4yipc2
  • Chain 'D':
    Compound: Superoxide dismutase [Mn/Fe]
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09738 (Start-201)
      • expression tag (202-203)
    Domains in SCOPe 2.05: d4yipd1, d4yipd2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yipA (A:)
    maillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladv
    eqipadirqslinnggghlnhalfwellspektkvtaevaaaineafgsfddfkaaftaa
    attrfgsgwawlvvdkegklevtstanqdtpisqglkpilaldvwehayylnyrnvrpny
    ikaffevinwntvarlyaealtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yipA (A:)
    aillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladve
    qipadirqslinnggghlnhalfwellspektkvtaevaaaineafgsfddfkaaftaaa
    ttrfgsgwawlvvdkegklevtstanqdtpisqglkpilaldvwehayylnyrnvrpnyi
    kaffevinwntvarlyaealtle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yipB (B:)
    maillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladv
    eqipadirqslinnggghlnhalfwellspektkvtaevaaaineafgsfddfkaaftaa
    attrfgsgwawlvvdkegklevtstanqdtpisqglkpilaldvwehayylnyrnvrpny
    ikaffevinwntvarlyaealtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yipB (B:)
    aillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladve
    qipadirqslinnggghlnhalfwellspektkvtaevaaaineafgsfddfkaaftaaa
    ttrfgsgwawlvvdkegklevtstanqdtpisqglkpilaldvwehayylnyrnvrpnyi
    kaffevinwntvarlyaealtle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yipC (C:)
    maillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladv
    eqipadirqslinnggghlnhalfwellspektkvtaevaaaineafgsfddfkaaftaa
    attrfgsgwawlvvdkegklevtstanqdtpisqglkpilaldvwehayylnyrnvrpny
    ikaffevinwntvarlyaealtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yipC (C:)
    aillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladve
    qipadirqslinnggghlnhalfwellspektkvtaevaaaineafgsfddfkaaftaaa
    ttrfgsgwawlvvdkegklevtstanqdtpisqglkpilaldvwehayylnyrnvrpnyi
    kaffevinwntvarlyaealt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4yipD (D:)
    maillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladv
    eqipadirqslinnggghlnhalfwellspektkvtaevaaaineafgsfddfkaaftaa
    attrfgsgwawlvvdkegklevtstanqdtpisqglkpilaldvwehayylnyrnvrpny
    ikaffevinwntvarlyaealtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yipD (D:)
    aillpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigenlevlladve
    qipadirqslinnggghlnhalfwellspektkvtaevaaaineafgsfddfkaaftaaa
    ttrfgsgwawlvvdkegklevtstanqdtpisqglkpilaldvwehayylnyrnvrpnyi
    kaffevinwntvarlyaealtle