PDB entry 4yij

View 4yij on RCSB PDB site
Description: Crystal structure of Staphylcoccal nuclease variant Delta+PHS A109E at cryogenic temperature
Class: hydrolase
Keywords: nuclease, hyperstable, pdTp, hydrolase, ionizable group
Deposited on 2015-03-02, released 2015-03-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclease A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (43-44)
      • engineered mutation (102)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.05: d4yija_
  • Chain 'B':
    Compound: Nuclease A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • engineered mutation (43-44)
      • engineered mutation (102)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.05: d4yijb_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yijA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglekvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yijA (A:)
    kklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenak
    kievefdkgqrtdkygrglayiyadgkmvnealvrqglekvayvykgnntheqllrkaea
    qakkeklniws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yijB (B:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglekvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yijB (B:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglekvayvykgnntheqllr
    kaeaqakkeklniwse