PDB entry 4yii

View 4yii on RCSB PDB site
Description: Structure of an APC2-UBCH10 complex reveals distinctive cullin-RING ligase mechanism for Anaphase-promoting complex/Cyclosome
Class: ligase/cell cycle
Keywords: ligase-cell cycle complex
Deposited on 2015-03-02, released 2015-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anaphase-promoting complex subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC2, APC2, KIAA1406
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Ubiquitin-conjugating enzyme E2 C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2C, UBCH10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4yiiu_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4yiiU (U:)
    gsargpvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklsle
    fpsgypynaptvkfltpcyhpnvdtqgnicldilkekwsalydvrtillsiqsllgepni
    dsplnthaaelwknptafkkylqetyskqvtsqep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yiiU (U:)
    gpvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklslefpsg
    ypynaptvkfltpcyhpnvdtqgnicldilkekwsalydvrtillsiqsllgepnidspl
    nthaaelwknptafkkylqetyskq