PDB entry 4yi3

View 4yi3 on RCSB PDB site
Description: Crystal structure of Gpb in complex with 4a
Class: transferase
Keywords: alpha and beta protein, transferase
Deposited on 2015-02-27, released 2015-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yi3a_
  • Heterogens: PLP, 4D0, IMP, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yi3A (A:)
    msrplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtv
    rdhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldm
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeea
    ddwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvn
    tmrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerl
    dwdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafp
    gdvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkf
    qnktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkq
    enklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvv
    prtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipa
    adlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvd
    rldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyee
    yvkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapde
    kip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yi3A (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    gyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkssnfdafp
    dkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwpvh
    lletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagsh
    avngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigee
    yisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkri
    heykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvv
    nhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltig
    tmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgff
    spkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgk
    fssdrtiaqyareiwgvepsrqrlpa