PDB entry 4yha

View 4yha on RCSB PDB site
Description: Crystal structure of the complex of Helicobacter pylori alpha-Carbonic Anhydrase with methazolamide
Class: lyase
Keywords: zinc metalloenzyme, methazolamide, LYASE
Deposited on 2015-02-27, released 2015-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yhaa_
  • Chain 'B':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yhab_
  • Chain 'C':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yhac_
  • Chain 'D':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yhad_
  • Chain 'E':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yhae_
  • Chain 'F':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yhaf_
  • Chain 'G':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yhag_
  • Chain 'H':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yhah_
  • Heterogens: ZN, CL, MZM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yhaA (A:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yhaA (A:)
    tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkav
    ffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrll
    vlaigfeegkenpnldpilegiqkkfkevaldaflpksinyyhfngsltappctegvawf
    vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yhaB (B:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yhaB (B:)
    tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtadlqfkyaaskpkavfft
    hhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvla
    igfeegkenpnldpilegiqnfkevaldaflpksinyyhfngsltappctegvawfviee
    plevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yhaC (C:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yhaC (C:)
    tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkav
    ffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrll
    vlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegva
    wfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4yhaD (D:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yhaD (D:)
    wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqddlqfkyaaskpkavffth
    htlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvlai
    gfeegkenpnldpilegiqkkevaldaflpksinyyhfngsltappctegvawfvieepl
    evsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4yhaE (E:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yhaE (E:)
    tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdklqfkyaaskpkavff
    thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
    aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf
    vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4yhaF (F:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yhaF (F:)
    wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavff
    thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
    aigfeeenpnldpilegiqkkdaflpksinyyhfngsltappctegvawfvieeplevsa
    kqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4yhaG (G:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yhaG (G:)
    ntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdlqfkyaaskpkavff
    thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
    aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf
    vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4yhaH (H:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yhaH (H:)
    wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavff
    thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
    aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf
    vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr