PDB entry 4yh2

View 4yh2 on RCSB PDB site
Description: Glutathione Transferase E6 from Drosophila melanogaster
Class: transferase
Keywords: Transferase, Drosophila
Deposited on 2015-02-26, released 2016-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S transferase E6
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: GstE6, CG17530, Dmel_CG17530
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yh2a1, d4yh2a2
  • Chain 'B':
    Compound: Glutathione S transferase E6
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: GstE6, CG17530, Dmel_CG17530
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yh2b1, d4yh2b2
  • Chain 'C':
    Compound: Glutathione S transferase E6
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: GstE6, CG17530, Dmel_CG17530
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yh2c1, d4yh2c2
  • Chain 'D':
    Compound: Glutathione S transferase E6
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: GstE6, CG17530, Dmel_CG17530
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yh2d1, d4yh2d2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yh2A (A:)
    mvkltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptled
    dghyiwdshaiiaylvskyadsdalypkdplkravvdqrlhfesgvvfangirsisksvl
    fqgqtkvpkerydaiieiydfvetflkgqdyiagnqltiadfslvssvasleafvaldtt
    kyprigawikkleqlpyyeeangkgvrqlvaifkktnftfea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yh2A (A:)
    vkltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptledd
    ghyiwdshaiiaylvskyadsdalypkdplkravvdqrlhfesgvvfangirsisksvlf
    qgqtkvpkerydaiieiydfvetflkgqdyiagnqltiadfslvssvasleafvaldttk
    yprigawikkleqlpyyeeangkgvrqlvaifkktnftfea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yh2B (B:)
    mvkltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptled
    dghyiwdshaiiaylvskyadsdalypkdplkravvdqrlhfesgvvfangirsisksvl
    fqgqtkvpkerydaiieiydfvetflkgqdyiagnqltiadfslvssvasleafvaldtt
    kyprigawikkleqlpyyeeangkgvrqlvaifkktnftfea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yh2B (B:)
    kltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptleddg
    hyiwdshaiiaylvskyadsdalypkdplkravvdqrlhfesgvvfangirsisksvlfq
    gqtkvpkerydaiieiydfvetflkgqdyiagnqltiadfslvssvasleafvaldttky
    prigawikkleqlpyyeeangkgvrqlvaifkktnftfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yh2C (C:)
    mvkltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptled
    dghyiwdshaiiaylvskyadsdalypkdplkravvdqrlhfesgvvfangirsisksvl
    fqgqtkvpkerydaiieiydfvetflkgqdyiagnqltiadfslvssvasleafvaldtt
    kyprigawikkleqlpyyeeangkgvrqlvaifkktnftfea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yh2C (C:)
    kltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptleddg
    hyiwdshaiiaylvskyadsdalypkdplkravvdqrlhfesgvvfangirsisksvlfq
    gqtkvpkerydaiieiydfvetflkgqdyiagnqltiadfslvssvasleafvaldttky
    prigawikkleqlpyyeeangkgvrqlvaifkktnftfea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4yh2D (D:)
    mvkltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptled
    dghyiwdshaiiaylvskyadsdalypkdplkravvdqrlhfesgvvfangirsisksvl
    fqgqtkvpkerydaiieiydfvetflkgqdyiagnqltiadfslvssvasleafvaldtt
    kyprigawikkleqlpyyeeangkgvrqlvaifkktnftfea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yh2D (D:)
    mvkltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptled
    dghyiwdshaiiaylvskyadsdalypkdplkravvdqrlhfesgvvfangirsisksvl
    fqgqtkvpkerydaiieiydfvetflkgqdyiagnqltiadfslvssvasleafvaldtt
    kyprigawikkleqlpyyeeangkgvrqlvaifkktnftfe