PDB entry 4ygz

View 4ygz on RCSB PDB site
Description: crystal structure of the r111k:y134f:t54v:r132q:p39y:r59y mutant of human cellular retinoic acid binding protein II with retinal at 2.06 angstrom resolution - visible light irradiated crystal -3rd cycle
Class: transport protein
Keywords: Photo swithcable protein, Retinal isomerization, Retinal iminium protonated Schiff base pKa change, protein engineering, TRANSPORT PROTEIN
Deposited on 2015-02-26, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered mutation (38)
      • engineered mutation (53)
      • engineered mutation (58)
      • engineered mutation (110)
      • engineered mutation (131)
      • engineered mutation (133)
    Domains in SCOPe 2.07: d4ygza_
  • Heterogens: RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ygzA (A:)
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskyaveikqegdtfyikvsttvyt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndgeli
ltmtaddvvctqvfvre