PDB entry 4ygq

View 4ygq on RCSB PDB site
Description: Crystal structure of HAD phosphatase from Thermococcus onnurineus
Class: hydrolase
Keywords: HAD phosphatase, substrate selectivity, HYDROLASE
Deposited on 2015-02-26, released 2015-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydrolase
    Species: Thermococcus onnurineus (strain NA1) [TaxId:523850]
    Gene: TON_0338
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YTD6 (0-213)
      • expression tag (214)
    Domains in SCOPe 2.07: d4ygqa1, d4ygqa2
  • Heterogens: TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ygqA (A:)
    mkavlfdidgtilteeplimlflpqvydklsrklgiskdearerflseilgrrdsydwhd
    wnfffklfdldlkyeelleryphklqvypdtiptlewlrdtgyklgivtsgpkyqrlklk
    ltglldyfdvvitrddvnaikpepkiflytierlgvepgeavmvgdslsqdvygaksvgm
    tavwinrngdrgynmadyeirtlyelrkilggervdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygqA (A:)
    mkavlfdidgtilteeplimlflpqvydklsrklgiskdearerflseilgrrdsydwhd
    wnfffklfdldlkyeelleryphklqvypdtiptlewlrdtgyklgivtsgpkyqrlklk
    ltglldyfdvvitrddvnaikpepkiflytierlgvepgeavmvgdslsqdvygaksvgm
    tavwinrngdrgynmadyeirtlyelrkilggerv