PDB entry 4ygf

View 4ygf on RCSB PDB site
Description: Crystal structure of the complex of Helicobacter pylori alpha-Carbonic Anhydrase with acetazolamide
Class: lyase
Keywords: periplasm, zinc metalloenzyme, LYASE
Deposited on 2015-02-26, released 2015-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ygfa_
  • Chain 'B':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ygfb_
  • Chain 'C':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ygfc_
  • Chain 'D':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ygfd_
  • Chain 'E':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ygfe_
  • Chain 'F':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ygff_
  • Chain 'G':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ygfg_
  • Chain 'H':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ygfh_
  • Heterogens: ZN, CL, AZM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ygfA (A:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygfA (A:)
    kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavf
    fthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllv
    laigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvaw
    fvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ygfB (B:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygfB (B:)
    tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtdlqfkyaaskpkavffth
    htlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvlai
    gfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawfvi
    eeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ygfC (C:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygfC (C:)
    tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkav
    ffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrll
    vlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegva
    wfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ygfD (D:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygfD (D:)
    kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavf
    fthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllv
    laigfgkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawfv
    ieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ygfE (E:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygfE (E:)
    kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavf
    fthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllv
    laigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvaw
    fvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ygfF (F:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygfF (F:)
    wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavff
    thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
    aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf
    vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ygfG (G:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygfG (G:)
    ntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpka
    vffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrl
    lvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegv
    awfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ygfH (H:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygfH (H:)
    wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavff
    thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
    aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf
    vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr