PDB entry 4yg3

View 4yg3 on RCSB PDB site
Description: Structural basis of glycan recognition in neonate-specific rotaviruses
Class: viral protein
Keywords: rotavirus, structural biology, glycan, VIRAL PROTEIN
Deposited on 2015-02-25, released 2015-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Outer capsid protein VP4
  Species: Rotavirus A [TaxId:10930]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35746 (2-162)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d4yg3a1, d4yg3a2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4yg3A (A:)
  gsldgpyapdssnlpsncwylvnpsndgvvfsvtdnstfwmftylvlpntaqtnvtvnvm
  netvnisidnsgstyrfvdyiktsstqaygsrnylntahrlqayrrdgdgnisnywgadt
  qgdlrvgtysnpvpnavinlnadfyvipdsqqetcteyirggl