PDB entry 4yfw

View 4yfw on RCSB PDB site
Description: Structural basis of glycan recognition in neonate-specific rotaviruses
Class: viral protein
Keywords: rotavirus, structural biology, glycan, VIRAL PROTEIN
Deposited on 2015-02-25, released 2015-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4yfwa_
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4yfwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yfwA (A:)
    gsaldgpytpdssnlpsnywylinplndgvvfsvtnnstfwmftylilpntaqtnvtvnv
    mnetvnisidnsgstyrfvdyfktsstqsyrqrnylitehrlqayrrdesgnisnywgss
    tygdlrvgtyfnpvlnavinlnadfyiipdsqqekcteyikggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yfwA (A:)
    ldgpytpdssnlpsnywylinplndgvvfsvtnnstfwmftylilpntaqtnvtvnvmne
    tvnisidnsgstyrfvdyfktsstqsyrqrnylitehrlqayrrdesgnisnywgsstyg
    dlrvgtyfnpvlnavinlnadfyiipdsqqekcteyikggl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yfwB (B:)
    gsaldgpytpdssnlpsnywylinplndgvvfsvtnnstfwmftylilpntaqtnvtvnv
    mnetvnisidnsgstyrfvdyfktsstqsyrqrnylitehrlqayrrdesgnisnywgss
    tygdlrvgtyfnpvlnavinlnadfyiipdsqqekcteyikggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yfwB (B:)
    ldgpytpdssnlpsnywylinplndgvvfsvtnnstfwmftylilpntaqtnvtvnvmne
    tvnisidnsgstyrfvdyfktsstqsyrqrnylitehrlqayrrdesgnisnywgsstyg
    dlrvgtyfnpvlnavinlnadfyiipdsqqekcteyikggl