PDB entry 4yek

View 4yek on RCSB PDB site
Description: X-ray structure of the thymidine phosphorylase from Salmonella typhimurium in complex with thymidine
Class: transferase
Keywords: thymidine phosphorylase, nucleoside, metabolism, transferase
Deposited on 2015-02-24, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: deoA, STM4568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yeka1, d4yeka2, d4yeka3
  • Chain 'B':
    Compound: thymidine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: deoA, STM4568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yekb1, d4yekb2, d4yekb3
  • Heterogens: SO4, THM, PGE, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yekA (A:)
    mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglght
    ggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsi
    plitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearakl
    qavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtralg
    mavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavkaa
    iilddkapastpsvyrrite
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yekB (B:)
    mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglght
    ggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsi
    plitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearakl
    qavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtralg
    mavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavkaa
    iilddkapastpsvyrrite