PDB entry 4yee

View 4yee on RCSB PDB site
Description: beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin
Class: sugar binding protein
Keywords: carbohydrate binding module (CBM), AMP-activated protein kinase (AMPK), glycogen, SUGAR BINDING PROTEIN
Deposited on 2015-02-24, released 2015-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yeea_
  • Chain 'B':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (7)
    Domains in SCOPe 2.06: d4yeeb1, d4yeeb2
  • Chain 'C':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (7)
    Domains in SCOPe 2.06: d4yeec1, d4yeec2
  • Chain 'D':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yeed_
  • Chain 'E':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (5-7)
    Domains in SCOPe 2.06: d4yeee1, d4yeee2
  • Chain 'F':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (5-7)
    Domains in SCOPe 2.06: d4yeef1, d4yeef2
  • Chain 'G':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (7)
    Domains in SCOPe 2.06: d4yeeg1, d4yeeg2
  • Chain 'H':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (5-7)
    Domains in SCOPe 2.06: d4yeeh1, d4yeeh2
  • Chain 'I':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (5-7)
    Domains in SCOPe 2.06: d4yeei1, d4yeei2
  • Chain 'J':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (5-7)
    Domains in SCOPe 2.06: d4yeej1, d4yeej2
  • Chain 'K':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yeek_
  • Chain 'L':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yeel_
  • Chain 'M':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (5-7)
    Domains in SCOPe 2.06: d4yeem1, d4yeem2
  • Chain 'N':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (6-7)
    Domains in SCOPe 2.06: d4yeen1, d4yeen2
  • Chain 'O':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (6-7)
    Domains in SCOPe 2.06: d4yeeo1, d4yeeo2
  • Chain 'P':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (5-7)
    Domains in SCOPe 2.06: d4yeep1, d4yeep2
  • Chain 'Q':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (6-7)
    Domains in SCOPe 2.06: d4yeeq1, d4yeeq2
  • Chain 'R':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (6-7)
    Domains in SCOPe 2.06: d4yeer1, d4yeer2
  • Heterogens: GOL, 4CQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yeeA (A:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeA (A:)
    qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv
    hdpsepvvtsqlgtinnlihvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yeeB (B:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeB (B:)
    sqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqw
    vhdpsepvvtsqlgtinnlihvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yeeC (C:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeC (C:)
    sqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqw
    vhdpsepvvtsqlgtinnlihvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4yeeD (D:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeD (D:)
    ptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwvhdp
    sepvvtsqlgtinnlihvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4yeeE (E:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeE (E:)
    pnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdg
    qwvhdpsepvvtsqlgtinnlihvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4yeeF (F:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeF (F:)
    pnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdg
    qwvhdpsepvvtsqlgtinnlihvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4yeeG (G:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeG (G:)
    sqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqw
    vhdpsepvvtsqlgtinnlihvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4yeeH (H:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeH (H:)
    pnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdg
    qwvhdpsepvvtsqlgtinnlihvk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4yeeI (I:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeI (I:)
    pnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdg
    qwvhdpsepvvtsqlgtinnlihvk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4yeeJ (J:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeJ (J:)
    pnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdg
    qwvhdpsepvvtsqlgtinnlihvk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4yeeK (K:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeK (K:)
    qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv
    hdpsepvvtsqlgtinnlihvk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4yeeL (L:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeL (L:)
    qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv
    hdpsepvvtsqlgtinnlihvk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4yeeM (M:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeM (M:)
    pnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdg
    qwvhdpsepvvtsqlgtinnlihvk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4yeeN (N:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeN (N:)
    nsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgq
    wvhdpsepvvtsqlgtinnlihvk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4yeeO (O:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeO (O:)
    nsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgq
    wvhdpsepvvtsqlgtinnlihvk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4yeeP (P:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeP (P:)
    pnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdg
    qwvhdpsepvvtsqlgtinnlihvk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4yeeQ (Q:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeQ (Q:)
    nsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgq
    wvhdpsepvvtsqlgtinnlihvk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4yeeR (R:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yeeR (R:)
    nsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgq
    wvhdpsepvvtsqlgtinnlihvk