PDB entry 4yea

View 4yea on RCSB PDB site
Description: Crystal structure of cisplatin bound to a human copper chaperone (dimer) - new refinement
Class: metal transport
Keywords: Re-refinement of 3iwx, cisplatin, platinum, Metal-binding, METAL TRANSPORT
Deposited on 2015-02-23, released 2015-03-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper transport protein atox1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATOX1, HAH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4yeaa_
  • Chain 'B':
    Compound: copper transport protein atox1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATOX1, HAH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4yeab_
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yeaA (A:)
    pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
    vsylgle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yeaB (B:)
    pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
    vsylgle