PDB entry 4yea

View 4yea on RCSB PDB site
Description: Crystal structure of cisplatin bound to a human copper chaperone (dimer) - new refinement
Class: metal transport
Keywords: Re-refinement of 3iwx, cisplatin, platinum, Metal-binding, METAL TRANSPORT
Deposited on 2015-02-23, released 2015-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: copper transport protein atox1
  Species: Homo sapiens [TaxId:9606]
  Gene: ATOX1, HAH1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00244 (0-66)
  Domains in SCOPe 2.08: d4yeaa_
• Chain 'B':
  Compound: copper transport protein atox1
  Species: Homo sapiens [TaxId:9606]
  Gene: ATOX1, HAH1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00244 (0-66)
  Domains in SCOPe 2.08: d4yeab_
• Heterogens: CU, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4yeaA (A:)
  pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
  vsylgle
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4yeaB (B:)
  pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
  vsylgle