PDB entry 4ye4

View 4ye4 on RCSB PDB site
Description: Crystal Structure of Neutralizing Antibody HJ16 in Complex with HIV-1 gp120
Class: Viral protein/Immune system
Keywords: HIV1, antibody, gp120, complex, Viral protein-Immune system complex
Deposited on 2015-02-23, released 2015-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: HT593.1 gp120
    Species: Human immunodeficiency virus [TaxId:12721]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YE4
  • Chain 'H':
    Compound: Heavy chain human antibody HJ16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YE4 (Start-227)
  • Chain 'L':
    Compound: Light chain of HJ16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YE4 (Start-217)
    Domains in SCOPe 2.07: d4ye4l1, d4ye4l2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4ye4L (L:)
    dvvmtqspeflavslgeratlecksshsllyapydkdalvwyqqkpgqppkllldwassr
    rsgvsdrfsatsasgryftltisnfraddvatyycqqtrwtpptfgggtkvdlnrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ye4L (L:)
    vvmtqspeflavslgeratlecksshsllyapydkdalvwyqqkpgqppkllldwassrr
    sgvsdrfsatsasgryftltisnfraddvatyycqqtrwtpptfgggtkvdlnrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnr