PDB entry 4ye1

View 4ye1 on RCSB PDB site
Description: A cytochrome c plus calixarene structure - alternative ligand binding mode
Class: electron transport
Keywords: protein surface recognition, lysine binding, Electron transport
Deposited on 2015-02-23, released 2015-05-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered mutation (17)
    Domains in SCOPe 2.06: d4ye1a_
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered mutation (17)
    Domains in SCOPe 2.06: d4ye1b_
  • Heterogens: HEM, T3Y, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ye1A (A:)
tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ye1B (B:)
tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace