PDB entry 4ydx

View 4ydx on RCSB PDB site
Description: Crystal structure of cisplatin bound to a human copper chaperone (monomer) - new refinement
Class: metal transport
Keywords: Re-refinement of 3iwl, cisplatin, platinum, Metal-binding, METAL TRANSPORT
Deposited on 2015-02-23, released 2015-03-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper transport protein atox1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATOX1, HAH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ydxa_
  • Heterogens: PT, SO4, TCE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ydxA (A:)
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgle