PDB entry 4ydo

View 4ydo on RCSB PDB site
Description: crystal structure of candida albicans protein farnesyltransferase in apo form
Class: transferase
Keywords: Farnesyl transferase, TRANSFERASE
Deposited on 2015-02-22, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
    Species: Candida albicans [TaxId:5476]
    Gene: RAM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y765
      • conflict (61)
      • conflict (64)
    Domains in SCOPe 2.07: d4ydoa_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Candida albicans [TaxId:237561]
    Gene: RAM1, CaO19.12513
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ydoA (A:)
    mgsshhhhhhsqdpnsssarlqvdmtdskydysditpvdinteepqicqilydedykqim
    gillslmkaeeyseralhitelginelashytiwiyrfnilknlpnrnlydeldwceeia
    ldneknyqiwnyrqliigqimelnnndfdpyrefpileamlssdpknhhvwsyrkwlvdt
    fdlhndakelsfvdkvidtdlknnsawshrffllfskkhlatdntideelnyvkdkivkc
    pqnpstwnyllgiherfdrsitqleefslqfvdlekdqvtssfaletlakiytqqkkyne
    srtvydllkskydpirsnfwdyqisklts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ydoA (A:)
    tdskydysditpvdinteepqicqilydedykqimgillslmkaeeyseralhitelgin
    elashytiwiyrfnilknlpnrnlydeldwceeialdneknyqiwnyrqliigqimelnn
    ndfdpyrefpileamlssdpknhhvwsyrkwlvdtfdlhndakelsfvdkvidtdlknns
    awshrffllfskkhlatdntideelnyvkdkivkcpqnpstwnyllgiherfdrsitqle
    efslqfvdlekdqvtssfaletlakiytqqkkynesrtvydllkskydpirsnfwdyqis
    klt
    

  • Chain 'B':
    No sequence available.