PDB entry 4ycu

View 4ycu on RCSB PDB site
Description: Crystal structure of cladosporin in complex with human lysyl-tRNA synthetase
Class: ligase/ ligase inhibitor
Keywords: Inhibitor, Complex, LysRS, cladosporin, ligase- ligase inhibitor complex
Deposited on 2015-02-20, released 2015-06-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine--tRNA ligase
    Species: Homo sapiens [TaxId:9606]
    Gene: KARS, KIAA0070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ycua1, d4ycua2
  • Chain 'B':
    Compound: Lysine--tRNA ligase
    Species: Homo sapiens [TaxId:9606]
    Gene: KARS, KIAA0070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ycub1, d4ycub2
  • Chain 'C':
    Compound: Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: AIMP2, JTV1, PRO0992
    Database cross-references and differences (RAF-indexed):
  • Heterogens: KRS, LYS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ycuA (A:)
    msvdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkv
    agrihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnp
    gktkkgelsiipyeitllspclhmlphlhfglkdketryrqryldlilndfvrqkfiirs
    kiityirsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlv
    vggidrvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgs
    ykvtyhpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicv
    akavecppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfel
    fvmkkeicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwg
    mgidrvamfltdsnnikevllfpamkpedkken
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ycuA (A:)
    dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
    ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
    kkgelsiipyeitllspclhmlphlhfglkdketryrqryldlilndfvrqkfiirskii
    tyirsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlvvgg
    idrvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgsykv
    tyhpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicvaka
    vecppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfelfvm
    kkeicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwgmgi
    drvamfltdsnnikevllfpamkpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ycuB (B:)
    msvdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkv
    agrihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnp
    gktkkgelsiipyeitllspclhmlphlhfglkdketryrqryldlilndfvrqkfiirs
    kiityirsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlv
    vggidrvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgs
    ykvtyhpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicv
    akavecppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfel
    fvmkkeicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwg
    mgidrvamfltdsnnikevllfpamkpedkken
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ycuB (B:)
    dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
    ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
    kkgelsiipyeitllspclhmlphldketryrqryldlilndfvrqkfiirskiityirs
    fldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlvvggidrvy
    eigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgsykvtyhpd
    gpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicvakavecpp
    prttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfelfvmkkeic
    naytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwgmgidrvam
    fltdsnnikevllfpamkp
    

  • Chain 'C':
    No sequence available.