PDB entry 4ycj

View 4ycj on RCSB PDB site
Description: Structure of Acetobacter aceti PurE Y154F
Class: isomerase
Keywords: acidophile, PurE, purine biosynthesis, ISOMERASE
Deposited on 2015-02-20, released 2016-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ycja_
  • Chain 'B':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ycjb_
  • Heterogens: EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ycjA (A:)
    mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsah
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalfnpalaarletwralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ycjA (A:)
    sapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalfnpalaarletwralqtasvpnspit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ycjB (B:)
    mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsah
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalfnpalaarletwralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ycjB (B:)
    sapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalfnpalaarletwralqtasvpnspited