PDB entry 4ych

View 4ych on RCSB PDB site
Description: Crystal Structure of R111K:Y134F:T54V:R132Q:P39Q:R59Y mutant of human Cellular Retinoic Acid Binding ProteinII with Retinal at 1.96 Angstrom - UV irradiated Crystal for 1 hour - 2nd cycle
Class: transport protein
Keywords: Photo switchable protein, Retinal isomerization, Retinal PSB pKa change, Protein engineering, TRANSPORT PROTEIN
Deposited on 2015-02-20, released 2016-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered mutation (38)
      • engineered mutation (53)
      • engineered mutation (58)
      • engineered mutation (110)
      • engineered mutation (131)
      • engineered mutation (133)
    Domains in SCOPe 2.07: d4ycha_
  • Heterogens: RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ychA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskqaveikqegdtfyikvsttvyt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndgeli
    ltmtaddvvctqvfvre