PDB entry 4yc7

View 4yc7 on RCSB PDB site
Description: Crystal structure of human FMNL2 GBD-FH3 Domains bound to Cdc42-GppNHp
Class: signaling protein
Keywords: signaling protein, Armadillo repeat, Rho GTPase, cell cycle
Deposited on 2015-02-19, released 2015-05-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 42 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d4yc7a_
  • Chain 'B':
    Compound: Formin-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FMNL2, FHOD2, KIAA1902
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4yc7A (A:)
gamqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
agqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaale
p

    Sequence, based on observed residues (ATOM records): (download) 
    >4yc7A (A:)
amqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdta
gqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidl
rddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaale

  • Chain 'B':
    No sequence available.