PDB entry 4yc1

View 4yc1 on RCSB PDB site
Description: Structure of the human TSG101-UEV domain in the P321 space group
Class: cell cycle
Keywords: UEV domain Ubiquitin binding, cell cycle
Deposited on 2015-02-19, released 2016-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99816 (14-158)
      • expression tag (11-13)
    Domains in SCOPe 2.08: d4yc1a1, d4yc1a2
  • Chain 'B':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99816 (14-158)
      • expression tag (10-13)
    Domains in SCOPe 2.08: d4yc1b1, d4yc1b2
  • Chain 'C':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4yc1c_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yc1A (A:)
    mrgshhhhhhgmasmavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfnd
    gssrelmnltgtipvpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdan
    gkiylpylhewkhpqsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yc1A (A:)
    masmavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltg
    tipvpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhew
    khpqsdllgliqvmivvfgdeppvfsrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yc1B (B:)
    mrgshhhhhhgmasmavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfnd
    gssrelmnltgtipvpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdan
    gkiylpylhewkhpqsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yc1B (B:)
    gmasmavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnlt
    gtipvpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhe
    wkhpqsdllgliqvmivvfgdeppvfsrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4yc1C (C:)
    mrgshhhhhhgmasmavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfnd
    gssrelmnltgtipvpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdan
    gkiylpylhewkhpqsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yc1C (C:)
    vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
    yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
    dllgliqvmivvfgdeppvfsrp