PDB entry 4ybh

View 4ybh on RCSB PDB site
Description: Crystal structure of the human RAGE ectodomain (VC1C2 fragment) in complex with human S100A6
Class: signaling protein
Keywords: signaling complex, pattern recognition receptor, dimerization, EF-hand calcium binding protein, immunoglobulin domain, signaling protein
Deposited on 2015-02-18, released 2016-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Advanced glycosylation end product-specific receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AGER, RAGE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15109 (3-End)
      • expression tag (1-2)
  • Chain 'B':
    Compound: Protein S100-A6
    Species: Homo sapiens [TaxId:9606]
    Gene: S100a6, Cacy
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ybhb_
  • Heterogens: ZN, CL, ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4ybhB (B:)
gamacpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlme
dldrnkdqevnfqeyvtflgalaliynealkg

    Sequence, based on observed residues (ATOM records): (download) 
    >4ybhB (B:)
acpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
rnkdqevnfqeyvtflgalaliynealkg