PDB entry 4yag

View 4yag on RCSB PDB site
Description: Crystal structure of LigL in complex with NADH from Sphingobium sp. strain SYK-6
Class: oxidoreductase
Keywords: Short Chain Dehydrogenase/reductase SDR family, OXIDOREDUCTASE
Deposited on 2015-02-17, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C alpha-dehydrogenase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligL, SLG_33660
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yaga_
  • Chain 'B':
    Compound: C alpha-dehydrogenase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligL, SLG_33660
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yagb_
  • Heterogens: NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yagA (A:)
    mdiagttafitggasgigfgiaqrllangarlvladirqdhldearqffeerqqgrnvht
    irldvsdraqmaeaareceavmggpdilinnagidpsgpfkdatyqdwdyglainlmgpi
    ngimaftpgmrargrgghivntaslagltpmpsfmaiyatakaavitltetirdsmaedn
    igvtvlmpgpiksrihesgqnrperfragsglaeteqqlakrvvadnwmeptevgdmivd
    aivhnklyvsthgnwretcearfqalldsmpearpfdfgaslavpkeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yagA (A:)
    mdiagttafitggasgigfgiaqrllangarlvladirqdhldearqffeerqqgrnvht
    irldvsdraqmaeaareceavmggpdilinnagidpsgpfkdatyqdwdyglainlmgpi
    ngimaftpgmrargrgghivntaslagltpmpsfmaiyatakaavitltetirdsmaedn
    igvtvlmpgpiksrihesgqnrperfragsglaeteqqlakrvvadnwmeptevgdmivd
    aivhnklyvsthgnwretcearfqalldsmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yagB (B:)
    mdiagttafitggasgigfgiaqrllangarlvladirqdhldearqffeerqqgrnvht
    irldvsdraqmaeaareceavmggpdilinnagidpsgpfkdatyqdwdyglainlmgpi
    ngimaftpgmrargrgghivntaslagltpmpsfmaiyatakaavitltetirdsmaedn
    igvtvlmpgpiksrihesgqnrperfragsglaeteqqlakrvvadnwmeptevgdmivd
    aivhnklyvsthgnwretcearfqalldsmpearpfdfgaslavpkeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yagB (B:)
    mdiagttafitggasgigfgiaqrllangarlvladirqdhldearqffeerqqgrnvht
    irldvsdraqmaeaareceavmggpdilinnagidpsgpfkdatyqdwdyglainlmgpi
    ngimaftpgmrargrgghivntaslagltpmpsfmaiyatakaavitltetirdsmaedn
    igvtvlmpgpiksrihesgqnrperfragsglaeteqqlakrvvadnwmeptevgdmivd
    aivhnklyvsthgnwretcearfqalldsmp