PDB entry 4y9u

View 4y9u on RCSB PDB site
Description: rat CYPOR mutant - G143del
Class: oxidoreductase
Keywords: cytochrome P450 reductase, FMN binding, semiquinone, OXIDOREDUCTASE
Deposited on 2015-02-17, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH--cytochrome P450 reductase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Por
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y9ua1, d4y9ua2, d4y9ua3
  • Chain 'B':
    Compound: NADPH--cytochrome P450 reductase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Por
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y9ub1, d4y9ub2, d4y9ub3
  • Heterogens: FMN, FAD, NAP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y9uA (A:)
    iqttappvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpee
    ydladlsslpeidkslvvfcmatygedptdnaqdfydwlqetdvdltgvkfavfglgnkt
    yehfnamgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatg
    eessirqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgte
    rhlmhleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnk
    khpfpcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelyl
    swvvearrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavave
    yeaksgrvnkgvatswlrakepagenggralvpmfvrksqfrlpfksttpvimvgpgtgi
    apfmgfiqerawlreqgkevgetllyygcrrsdedylyreelarfhkdgaltqlnvafsr
    eqahkvyvqhllkrdrehlwkliheggahiyvcgdarnmakdvqntfydivaefgpmeht
    qavdyvkklmtkgrysldvws
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y9uA (A:)
    ppvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydlad
    lsslpeidkslvvfcmatyptdnaqdfydwlqetdvdltgvkfavfglgnktyehfnamg
    kyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveateessirqye
    lvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterhlmhleld
    isdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkhpfpcptt
    yrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylswvvearrh
    ilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveyeaksgrvn
    kgvatswlrakepagralvpmfvrksqfrlpfksttpvimvgpgtgiapfmgfiqerawl
    reqgkevgetllyygcrrsdedylyreelarfhkdgaltqlnvafsreqahkvyvqhllk
    rdrehlwkliheggahiyvcgdarnmakdvqntfydivaefgpmehtqavdyvkklmtkg
    rysldvws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y9uB (B:)
    iqttappvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpee
    ydladlsslpeidkslvvfcmatygedptdnaqdfydwlqetdvdltgvkfavfglgnkt
    yehfnamgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatg
    eessirqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgte
    rhlmhleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnk
    khpfpcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelyl
    swvvearrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavave
    yeaksgrvnkgvatswlrakepagenggralvpmfvrksqfrlpfksttpvimvgpgtgi
    apfmgfiqerawlreqgkevgetllyygcrrsdedylyreelarfhkdgaltqlnvafsr
    eqahkvyvqhllkrdrehlwkliheggahiyvcgdarnmakdvqntfydivaefgpmeht
    qavdyvkklmtkgrysldvws
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y9uB (B:)
    pvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladl
    sslpeidkslvvfcmatytdnaqdfydwlqetdvdltgvkfavfglgnktyehfnamgky
    vdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveairqyelvvhedm
    dvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterhlmhleldisdskir
    yesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkhpfpcpttyrtalty
    ylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylswvvearrhilailqd
    ypslrppidhlcellprlqaryysiassskvhpnsvhicavaveyeaksgrvnkgvatsw
    lrakeparalvpmfvrksqfrlpfksttpvimvgpgtgiapfmgfiqerawlreqgkevg
    etllyygcrrsdedylyreelarfhkdgaltqlnvafsreqahkvyvqhllkrdrehlwk
    liheggahiyvcgdarnmakdvqntfydivaefgpmehtqavdyvkklmtkgrysldvws