PDB entry 4y9f

View 4y9f on RCSB PDB site
Description: Crystal structure of V30M mutated transthyretin with bromide in complex with gamma-mangostin
Class: transport protein/inhibitor
Keywords: transthyretin, inhibitor, natural pruduct, transporter, amyloidosis, TRANSPORT PROTEIN-INHIBITOR complex
Deposited on 2015-02-17, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (61)
    Domains in SCOPe 2.07: d4y9fa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (61)
    Domains in SCOPe 2.07: d4y9fb_
  • Heterogens: MKT, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y9fA (A:)
    mrgshhhhhhgsmashrllllclaglvfvseagptgtgeskcplmvkvldavrgspainv
    amhvfrkaaddtwepfasgktsesgelhgltteeefvegiykveidtksywkalgispfh
    ehaevvftandsgprrytiaallspysysttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y9fA (A:)
    cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y9fB (B:)
    mrgshhhhhhgsmashrllllclaglvfvseagptgtgeskcplmvkvldavrgspainv
    amhvfrkaaddtwepfasgktsesgelhgltteeefvegiykveidtksywkalgispfh
    ehaevvftandsgprrytiaallspysysttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y9fB (B:)
    cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsrytiaallspysysttavvtn