PDB entry 4y99

View 4y99 on RCSB PDB site
Description: Core domain of human cardiac troponin
Class: contractile protein
Keywords: muscle regulation, calcium-binding, EF-hand, coiled-coil, myopathy, complex, CONTRACTILE PROTEIN
Deposited on 2015-02-17, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC1, TNNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (Start-160)
      • engineered mutation (34)
      • engineered mutation (83)
      • conflict (114)
    Domains in SCOPe 2.07: d4y99a_
  • Chain 'B':
    Compound: Troponin T, cardiac muscle
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45379
      • conflict (56)
    Domains in SCOPe 2.07: d4y99b_
  • Chain 'C':
    Compound: Troponin I, cardiac muscle
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNI3, TNNC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19429
      • engineered mutation (79)
      • engineered mutation (96)
  • Heterogens: CA, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y99A (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkim
    lqatgetiteddieelmkdgdknndgridydeflefmkgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y99A (A:)
    ddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
    devdedgsgtvdfdeflvmmvrsmgkseeelsdlfrmfdknadgyidleelkimlqatge
    titeddieelmkdgdknndgridydeflefmkgve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y99B (B:)
    hfggyiqkqaqterksgkrqterekkkkilaerrkvlaidhlnedqlrekakelwqtiyn
    leaekfdlqekfkqqkyeinvlrnrindnqkvsktrgkakvtgrwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y99B (B:)
    gkrqterekkkkilaerrkvlaidhlnedqlrekakelwqtiynleaekfdlqekfkqqk
    yeinvlrnrindnq
    

  • Chain 'C':
    No sequence available.