PDB entry 4y95

View 4y95 on RCSB PDB site
Description: Crystal structure of the kinase domain of Bruton's tyrosine kinase with mutations in the activation loop
Class: transferase
Keywords: Btk, kinase domain, TRANSFERASE
Deposited on 2015-02-16, released 2015-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-specific protein-tyrosine kinase
    Species: Bos taurus [TaxId:9913]
    Gene: BTK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3ZC95 (1-265)
      • expression tag (0)
      • engineered mutation (148-149)
      • engineered mutation (151)
      • engineered mutation (161)
      • engineered mutation (163)
      • engineered mutation (168)
      • engineered mutation (170-171)
      • engineered mutation (223)
    Domains in SCOPe 2.06: d4y95a1, d4y95a2
  • Chain 'B':
    Compound: Non-specific protein-tyrosine kinase
    Species: Bos taurus [TaxId:9913]
    Gene: BTK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3ZC95 (1-265)
      • expression tag (0)
      • engineered mutation (148-149)
      • engineered mutation (151)
      • engineered mutation (161)
      • engineered mutation (163)
      • engineered mutation (168)
      • engineered mutation (170-171)
      • engineered mutation (223)
    Domains in SCOPe 2.06: d4y95b1, d4y95b2
  • Chain 'C':
    Compound: Non-specific protein-tyrosine kinase
    Species: Bos taurus [TaxId:9913]
    Gene: BTK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3ZC95 (1-265)
      • expression tag (0)
      • engineered mutation (148-149)
      • engineered mutation (151)
      • engineered mutation (161)
      • engineered mutation (163)
      • engineered mutation (168)
      • engineered mutation (170-171)
      • engineered mutation (223)
    Domains in SCOPe 2.06: d4y95c1, d4y95c2
  • Chain 'D':
    Compound: Non-specific protein-tyrosine kinase
    Species: Bos taurus [TaxId:9913]
    Gene: BTK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3ZC95 (1-265)
      • engineered mutation (148-149)
      • engineered mutation (151)
      • engineered mutation (161)
      • engineered mutation (163)
      • engineered mutation (168)
      • engineered mutation (170-171)
      • engineered mutation (223)
    Domains in SCOPe 2.06: d4y95d_
  • Heterogens: 746, GOL, BME, PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4y95A (A:)
    aweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnls
    heklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyle
    skqflhrdlaarnclvndqgvvkvsdfgmtrfvlddeytsstgtkfpvkwaspevlmysk
    fssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlprphlaservyaimysc
    whekaderptfkillsnildvmdees
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4y95B (B:)
    aweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnls
    heklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyle
    skqflhrdlaarnclvndqgvvkvsdfgmtrfvlddeytsstgtkfpvkwaspevlmysk
    fssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlprphlaservyaimysc
    whekaderptfkillsnildvmdees
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4y95C (C:)
    aweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnls
    heklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyle
    skqflhrdlaarnclvndqgvvkvsdfgmtrfvlddeytsstgtkfpvkwaspevlmysk
    fssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlprphlaservyaimysc
    whekaderptfkillsnildvmdees
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y95D (D:)
    aweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnls
    heklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyle
    skqflhrdlaarnclvndqgvvkvsdfgmtrfvlddeytsstgtkfpvkwaspevlmysk
    fssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlprphlaservyaimysc
    whekaderptfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y95D (D:)
    weidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
    eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
    kqflhrdlaarnclvndqgvvkvsdfgmtrfvlddeytsstgtkfpvkwaspevlmyskf
    ssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlprphlaservyaimyscw
    hekaderptfkillsnildvmdees