PDB entry 4y92

View 4y92 on RCSB PDB site
Description: Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain E97T-Q128R mutant
Class: transferase
Keywords: beta sandwich, transferase
Deposited on 2015-02-16, released 2016-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-tyrosine kinase
    Species: Avian sarcoma virus PR2257/16 [TaxId:385048]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64817 (4-End)
      • expression tag (3)
      • engineered mutation (16)
      • engineered mutation (47)
    Domains in SCOPe 2.06: d4y92a1, d4y92a2
  • Heterogens: PGE, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y92A (A:)
    gshmtfvalydyesrtttdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y92A (A:)
    mtfvalydyesrtttdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvap