PDB entry 4y90

View 4y90 on RCSB PDB site
Description: Crystal structure of Triosephosphate Isomerase from Deinococcus radiodurans
Class: isomerase
Keywords: TIM Barrel, Isomerase, TPI
Deposited on 2015-02-16, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Deinococcus radiodurans [TaxId:243230]
    Gene: tpiA, DR_1339
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y90a_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Deinococcus radiodurans [TaxId:243230]
    Gene: tpiA, DR_1339
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y90b_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Deinococcus radiodurans [TaxId:243230]
    Gene: tpiA, DR_1339
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y90c_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Deinococcus radiodurans [TaxId:243230]
    Gene: tpiA, DR_1339
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y90d_
  • Heterogens: SO4, GOL, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y90A (A:)
    gshmqtllalnwkmnktptearswaeelttkyapaegvdlavlapaldlsalaanlpagi
    afggqdvsahesgaytgeisaamlkdagascvvvghserreyhdesdatvaakarqaqan
    gllpivcvgenldvrergehvpqtlaqlrgslegvgadvvvayepvwaigtgktatadda
    eelaaairgalreqygaraegirvlyggsvkpeniaeicgkpnvngalvggaslkvpdvl
    gmldalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y90A (A:)
    mqtllalnwkmnktptearswaeelttkyapaegvdlavlapaldlsalaanlpagiafg
    gqdvsahesgaytgeisaamlkdagascvvvghserreyhdesdatvaakarqaqangll
    pivcvgenldvrergehvpqtlaqlrgslegvgadvvvayepvwaigtgktataddaeel
    aaairgalreqygaraegirvlyggsvkpeniaeicgkpnvngalvggaslkvpdvlgml
    dalr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y90B (B:)
    gshmqtllalnwkmnktptearswaeelttkyapaegvdlavlapaldlsalaanlpagi
    afggqdvsahesgaytgeisaamlkdagascvvvghserreyhdesdatvaakarqaqan
    gllpivcvgenldvrergehvpqtlaqlrgslegvgadvvvayepvwaigtgktatadda
    eelaaairgalreqygaraegirvlyggsvkpeniaeicgkpnvngalvggaslkvpdvl
    gmldalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y90B (B:)
    mqtllalnwkmnktptearswaeelttkyapaegvdlavlapaldlsalaanlpagiafg
    gqdvsahesgaytgeisaamlkdagascvvvghserreyhdesdatvaakarqaqangll
    pivcvgenldvrergehvpqtlaqlrgslegvgadvvvayepvwaigtgktataddaeel
    aaairgalreqygaraegirvlyggsvkpeniaeicgkpnvngalvggaslkvpdvlgml
    dalr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y90C (C:)
    gshmqtllalnwkmnktptearswaeelttkyapaegvdlavlapaldlsalaanlpagi
    afggqdvsahesgaytgeisaamlkdagascvvvghserreyhdesdatvaakarqaqan
    gllpivcvgenldvrergehvpqtlaqlrgslegvgadvvvayepvwaigtgktatadda
    eelaaairgalreqygaraegirvlyggsvkpeniaeicgkpnvngalvggaslkvpdvl
    gmldalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y90C (C:)
    mqtllalnwkmnktptearswaeelttkyapaegvdlavlapaldlsalaanlpagiafg
    gqdvsahesgaytgeisaamlkdagascvvvghserreyhdesdatvaakarqaqangll
    pivcvgenldvrergehvpqtlaqlrgslegvgadvvvayepvwaigtgktataddaeel
    aaairgalreqygaraegirvlyggsvkpeniaeicgkpnvngalvggaslkvpdvlgml
    dalr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y90D (D:)
    gshmqtllalnwkmnktptearswaeelttkyapaegvdlavlapaldlsalaanlpagi
    afggqdvsahesgaytgeisaamlkdagascvvvghserreyhdesdatvaakarqaqan
    gllpivcvgenldvrergehvpqtlaqlrgslegvgadvvvayepvwaigtgktatadda
    eelaaairgalreqygaraegirvlyggsvkpeniaeicgkpnvngalvggaslkvpdvl
    gmldalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y90D (D:)
    mqtllalnwkmnktptearswaeelttkyapaegvdlavlapaldlsalaanlpagiafg
    gqdvsahesgaytgeisaamlkdagascvvvghserreyhdesdatvaakarqaqangll
    pivcvgenldvrergehvpqtlaqlrgslegvgadvvvayepvwaigtgktataddaeel
    aaairgalreqygaraegirvlyggsvkpeniaeicgkpnvngalvggaslkvpdvlgml
    dalr