PDB entry 4y8w

View 4y8w on RCSB PDB site
Description: Crystal Structure of Human Cytochrome P450 21A2 Progesterone Complex
Class: oxidoreductase
Keywords: steroid hydroxylation, monooxygenases, adrenal steroidogenesis, congenital adrenal hyperplasia, Addison's disease, kinetic isotope effects, OXIDOREDUCTASE
Deposited on 2015-02-16, released 2015-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 21-hydroxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: P450-CYP21B, CYP21A2, hCG_1999926
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16874 (10-End)
      • expression tag (9)
    Domains in SCOPe 2.07: d4y8wa1, d4y8wa2
  • Chain 'B':
    Compound: Cytochrome P450 21-hydroxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: P450-CYP21B, CYP21A2, hCG_1999926
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16874 (10-End)
      • expression tag (9)
    Domains in SCOPe 2.07: d4y8wb1, d4y8wb2
  • Chain 'C':
    Compound: Cytochrome P450 21-hydroxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: P450-CYP21B, CYP21A2, hCG_1999926
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16874 (10-End)
      • expression tag (9)
    Domains in SCOPe 2.07: d4y8wc1, d4y8wc2
  • Heterogens: SO4, HEM, STR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y8wA (A:)
    makktsskgklpplapgflhllqpdlpiyllgltqkfgpiyrlhlglqdvvvlnskrtie
    eamvkkwadfagrpepltyklvsrnypdlslgdysllwkahkkltrsalllgirdsmepv
    veqltqefcermraqpgtpvaieeefslltcsiicyltfgdkikddnlmpayykciqevl
    ktwshwsiqivdvipflrffpnpglrrlkqaiekrdhivemqlrqhkeslvagqwrdmmd
    ymlqgvaqpsmeegsgqlleghvhmaavdlliggtettantlswavvfllhhpeiqqrlq
    eeldhelgpgasssrvpykdrarlpllnatiaevlrlrpvvplalphrttrpssisgydi
    pegtviipnlqgahldetvwerphefwpdrflepgknsralafgcgarvclgeplarlel
    fvvltrllqaftllpsgdalpslqplphcsvilkmqpfqvrlqprgmgahspgqsqhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y8wA (A:)
    klpplapgflhllqpdlpiyllgltqkfgpiyrlhlglqdvvvlnskrtieeamvkkwad
    fagrpepltyklvsrnypdlslgdysllwkahkkltrsalllgirdsmepvveqltqefc
    ermraqpgtpvaieeefslltcsiicyltfgdkikddnlmpayykciqevlktwshwsiq
    ivdvipflrffpnpglrrlkqaiekrdhivemqlrqhkeslvagqwrdmmdymlqgvaql
    leghvhmaavdlliggtettantlswavvfllhhpeiqqrlqeeldhelsrvpykdrarl
    pllnatiaevlrlrpvvplalphrttrpssisgydipegtviipnlqgahldetvwerph
    efwpdrflgknsralafgcgarvclgeplarlelfvvltrllqaftllpsgdalpslqpl
    phcsvilkmqpfqvrlqprg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y8wB (B:)
    makktsskgklpplapgflhllqpdlpiyllgltqkfgpiyrlhlglqdvvvlnskrtie
    eamvkkwadfagrpepltyklvsrnypdlslgdysllwkahkkltrsalllgirdsmepv
    veqltqefcermraqpgtpvaieeefslltcsiicyltfgdkikddnlmpayykciqevl
    ktwshwsiqivdvipflrffpnpglrrlkqaiekrdhivemqlrqhkeslvagqwrdmmd
    ymlqgvaqpsmeegsgqlleghvhmaavdlliggtettantlswavvfllhhpeiqqrlq
    eeldhelgpgasssrvpykdrarlpllnatiaevlrlrpvvplalphrttrpssisgydi
    pegtviipnlqgahldetvwerphefwpdrflepgknsralafgcgarvclgeplarlel
    fvvltrllqaftllpsgdalpslqplphcsvilkmqpfqvrlqprgmgahspgqsqhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y8wB (B:)
    klpplapgflhllqpdlpiyllgltqkfgpiyrlhlglqdvvvlnskrtieeamvkkwad
    fagrpepltyklvsrnypdlslgdysllwkahkkltrsalllgirdsmepvveqltqefc
    ermraqpgtpvaieeefslltcsiicyltfgdkikddnlmpayykciqevlktwshwsiq
    ivdvipflrffpnpglrrlkqaiekrdhivemqlrqhkeslvagqwrdmmdymlqgvaqq
    lleghvhmaavdlliggtettantlswavvfllhhpeiqqrlqeeldhsrvpykdrarlp
    llnatiaevlrlrpvvplalphrttrpssisgydipegtviipnlqgahldetvwerphe
    fwpdrflepgknsralafgcgarvclgeplarlelfvvltrllqaftllpsgdalpslqp
    lphcsvilkmqpfqvrlqpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y8wC (C:)
    makktsskgklpplapgflhllqpdlpiyllgltqkfgpiyrlhlglqdvvvlnskrtie
    eamvkkwadfagrpepltyklvsrnypdlslgdysllwkahkkltrsalllgirdsmepv
    veqltqefcermraqpgtpvaieeefslltcsiicyltfgdkikddnlmpayykciqevl
    ktwshwsiqivdvipflrffpnpglrrlkqaiekrdhivemqlrqhkeslvagqwrdmmd
    ymlqgvaqpsmeegsgqlleghvhmaavdlliggtettantlswavvfllhhpeiqqrlq
    eeldhelgpgasssrvpykdrarlpllnatiaevlrlrpvvplalphrttrpssisgydi
    pegtviipnlqgahldetvwerphefwpdrflepgknsralafgcgarvclgeplarlel
    fvvltrllqaftllpsgdalpslqplphcsvilkmqpfqvrlqprgmgahspgqsqhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y8wC (C:)
    klpplapgflhllqpdlpiyllgltqkfgpiyrlhlglqdvvvlnskrtieeamvkkwad
    fagrpepltyklvsrnypdlslgdysllwkahkkltrsalllgirdsmepvveqltqefc
    ermraqpgtpvaieeefslltcsiicyltfgdkikddnlmpayykciqevlktwshwsiq
    ivdvipflrffpnpglrrlkqaiekrdhivemqlrqhkeslvagqwrdmmdymlqgvagq
    lleghvhmaavdlliggtettantlswavvfllhhpeiqqrlqeeldhesrvpykdrarl
    pllnatiaevlrlrpvvplalphrttrpssisgydipegtviipnlqgahldetvwerph
    efwpdrflepgknsralafgcgarvclgeplarlelfvvltrllqaftllpsgdalpslq
    plphcsvilkmqpfqvrlqprg