PDB entry 4y7m

View 4y7m on RCSB PDB site
Description: T6SS protein TssM C-terminal domain (835-1129) from EAEC
Class: membrane protein
Keywords: Type 6 secretion system, Alpha-beta fold, periplasmic protein, membrane protein
Deposited on 2015-02-15, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hi113 protein
    Species: LAMA GLAMA [TaxId:9844]
    Gene: hi113
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y7M (0-128)
    Domains in SCOPe 2.07: d4y7ma_
  • Chain 'B':
    Compound: Hi113 protein
    Species: LAMA GLAMA [TaxId:9844]
    Gene: hi113
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y7M (0-128)
    Domains in SCOPe 2.07: d4y7mb_
  • Chain 'C':
    Compound: Type VI secretion protein IcmF
    Species: Escherichia coli 2-156-04_S3_C3 [TaxId:1444178]
    Gene: AC43_2230
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Type VI secretion protein IcmF
    Species: Escherichia coli 2-156-04_S3_C3 [TaxId:1444178]
    Gene: AC43_2230
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4y7mA (A:)
    qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
    pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqgiyctdyiigpygmdywg
    kgtqvtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4y7mB (B:)
    qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
    pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqgiyctdyiigpygmdywg
    kgtqvtvss
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.