PDB entry 4y5z

View 4y5z on RCSB PDB site
Description: T=1 capsid structure of SeMV Ndel65CP fused with B-domain of S. aureus protein SpA at the N-terminus (P1 crystal form)
Class: virus
Keywords: coat protein, chimeric VLP, in vitro assembly, VIRUS
Deposited on 2015-02-12, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5z0_
  • Chain '1':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5z1_
  • Chain '2':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5z2_
  • Chain '3':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5z3_
  • Chain '4':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5z4_
  • Chain '5':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5z5_
  • Chain '6':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5z6_
  • Chain '7':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5z7_
  • Chain 'A':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5za_
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zb_
  • Chain 'C':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zc_
  • Chain 'D':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zd_
  • Chain 'E':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5ze_
  • Chain 'F':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zf_
  • Chain 'G':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zg_
  • Chain 'H':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zh_
  • Chain 'I':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zi_
  • Chain 'J':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zj_
  • Chain 'K':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zk_
  • Chain 'L':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zl_
  • Chain 'M':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zm_
  • Chain 'N':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zn_
  • Chain 'O':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zo_
  • Chain 'P':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zp_
  • Chain 'Q':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zq_
  • Chain 'R':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zr_
  • Chain 'S':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zs_
  • Chain 'T':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zt_
  • Chain 'U':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zu_
  • Chain 'V':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zv_
  • Chain 'W':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zw_
  • Chain 'X':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zx_
  • Chain 'Y':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zy_
  • Chain 'Z':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5zz_
  • Chain 'a':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'w':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'y':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >4y5z0 (0:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5z0 (0:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >4y5z1 (1:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5z1 (1:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmieptas
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >4y5z2 (2:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5z2 (2:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >4y5z3 (3:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5z3 (3:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmieptasa
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >4y5z4 (4:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5z4 (4:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >4y5z5 (5:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5z5 (5:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >4y5z6 (6:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5z6 (6:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >4y5z7 (7:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5z7 (7:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y5zA (A:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zA (A:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y5zB (B:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zB (B:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmieptasa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y5zC (C:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zC (C:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y5zD (D:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zD (D:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4y5zE (E:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zE (E:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4y5zF (F:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zF (F:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4y5zG (G:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zG (G:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4y5zH (H:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zH (H:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmieptas
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4y5zI (I:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zI (I:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4y5zJ (J:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zJ (J:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmieptasa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4y5zK (K:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zK (K:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4y5zL (L:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zL (L:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4y5zM (M:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zM (M:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmieptas
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4y5zN (N:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zN (N:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4y5zO (O:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zO (O:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4y5zP (P:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zP (P:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4y5zQ (Q:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zQ (Q:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4y5zR (R:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zR (R:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4y5zS (S:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zS (S:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4y5zT (T:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zT (T:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4y5zU (U:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zU (U:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4y5zV (V:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zV (V:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4y5zW (W:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zW (W:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4y5zX (X:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zX (X:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmieptasa
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4y5zY (Y:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zY (Y:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >4y5zZ (Z:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5zZ (Z:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmiepta
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'p':
    No sequence available.

  • Chain 'q':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 's':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    No sequence available.

  • Chain 'w':
    No sequence available.

  • Chain 'x':
    No sequence available.

  • Chain 'y':
    No sequence available.

  • Chain 'z':
    No sequence available.