PDB entry 4y5d

View 4y5d on RCSB PDB site
Description: CRYSTAL STRUCTURE OF ALiS2-STREPTAVIDIN COMPLEX
Class: biotin-binding protein
Keywords: BIOTIN-BINDING PROTEIN, Inhibitor
Deposited on 2015-02-11, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5da_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5db_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5dc_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y5dd_
  • Heterogens: MT6, PE3, DMS, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4y5dA (A:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    ps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4y5dB (B:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    ps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4y5dC (C:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    ps
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4y5dD (D:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    ps