PDB entry 4y4y

View 4y4y on RCSB PDB site
Description: T=1 capsid structure of SeMV Ndel65CP fused with B-domain of S. aureus protein SpA at the N-terminus (C2 crystal form)
Class: virus
Keywords: Coat protein, chimeric VLP, in vitro assembly, VIRUS
Deposited on 2015-02-11, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4ya_
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yb_
  • Chain 'C':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yc_
  • Chain 'D':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yd_
  • Chain 'E':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4ye_
  • Chain 'F':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yf_
  • Chain 'G':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yg_
  • Chain 'H':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yh_
  • Chain 'I':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yi_
  • Chain 'J':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yj_
  • Chain 'K':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yk_
  • Chain 'L':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yl_
  • Chain 'M':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4ym_
  • Chain 'N':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yn_
  • Chain 'O':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yo_
  • Chain 'P':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yp_
  • Chain 'Q':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yq_
  • Chain 'R':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yr_
  • Chain 'S':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4ys_
  • Chain 'T':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yt_
  • Chain 'U':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yu_
  • Chain 'V':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yv_
  • Chain 'W':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yw_
  • Chain 'X':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yx_
  • Chain 'Y':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yy_
  • Chain 'Z':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y4yz_
  • Chain 'a':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Immunoglobulin G-binding protein A,Coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Gene: spa, SAOUHSC_00069
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y4yA (A:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yA (A:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y4yB (B:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yB (B:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y4yC (C:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yC (C:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y4yD (D:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yD (D:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4y4yE (E:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yE (E:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4y4yF (F:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yF (F:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4y4yG (G:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yG (G:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4y4yH (H:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yH (H:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4y4yI (I:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yI (I:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4y4yJ (J:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yJ (J:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4y4yK (K:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yK (K:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4y4yL (L:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yL (L:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4y4yM (M:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yM (M:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4y4yN (N:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yN (N:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4y4yO (O:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yO (O:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4y4yP (P:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yP (P:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4y4yQ (Q:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yQ (Q:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4y4yR (R:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yR (R:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4y4yS (S:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yS (S:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4y4yT (T:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yT (T:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4y4yU (U:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yU (U:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4y4yV (V:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yV (V:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4y4yW (W:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yW (W:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4y4yX (X:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yX (X:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4y4yY (Y:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yY (Y:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >4y4yZ (Z:)
    mrgshhhhhhgmasmdnkfnkeqqnafyeilnmpnlneeqrngfiqslkddpsqsanlls
    eakklnesqapkegselemavsssrggitvlthselsaeigvtdsivvsselvmpytvgt
    wlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvs
    gqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatp
    lvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4yZ (Z:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmiepta
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.