PDB entry 4y4l

View 4y4l on RCSB PDB site
Description: Crystal structure of yeast Thi4-C205S
Class: biosynthetic protein
Keywords: biosynthetic protein
Deposited on 2015-02-10, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine thiazole synthase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: THI4, ESP35, MOL1, YGR144W, G6620
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32318
      • engineered mutation (224)
    Domains in SCOPe 2.07: d4y4la_
  • Chain 'B':
    Compound: Thiamine thiazole synthase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: THI4, ESP35, MOL1, YGR144W, G6620
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32318 (Start-345)
      • engineered mutation (224)
    Domains in SCOPe 2.07: d4y4lb_
  • Chain 'C':
    Compound: Thiamine thiazole synthase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: THI4, ESP35, MOL1, YGR144W, G6620
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32318
      • engineered mutation (224)
    Domains in SCOPe 2.07: d4y4lc_
  • Chain 'D':
    Compound: Thiamine thiazole synthase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: THI4, ESP35, MOL1, YGR144W, G6620
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32318
      • engineered mutation (224)
    Domains in SCOPe 2.07: d4y4ld_
  • Heterogens: 48N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y4lA (A:)
    mgsshhhhhhssglvprgshmsatstatstsasqlhlnstpvthclsdivkkedwsdfkf
    apirestvsramtsryfkdldkfavsdviivgagssglsaayviaknrpdlkvciiessv
    apgggswlggqlfsamvmrkpahlflqeleipyedegdyvvvkhaalfistvlskvlqlp
    nvklfnatcvedlvtrpptekgevtvagvvtnwtlvtqahgtqcsmdpnvielagykndg
    trdlsqkhgvilsttghdgpfgafcakrivdidqnqklggmkgldmnhaehdvvihsgay
    agvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqilkhfaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4lA (A:)
    vthclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgagssglsaa
    yviaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipyedegdyvv
    vkhaalfistvlskvlqlpnvklfnatcvedlvtrpptekgevtvagvvtnwtlvtqahg
    tcsmdpnvielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidqnqklggmk
    gldmnhaehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqilk
    hfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y4lB (B:)
    mgsshhhhhhssglvprgshmsatstatstsasqlhlnstpvthclsdivkkedwsdfkf
    apirestvsramtsryfkdldkfavsdviivgagssglsaayviaknrpdlkvciiessv
    apgggswlggqlfsamvmrkpahlflqeleipyedegdyvvvkhaalfistvlskvlqlp
    nvklfnatcvedlvtrpptekgevtvagvvtnwtlvtqahgtqcsmdpnvielagykndg
    trdlsqkhgvilsttghdgpfgafcakrivdidqnqklggmkgldmnhaehdvvihsgay
    agvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqilkhfaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4lB (B:)
    vthclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgagssglsaa
    yviaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipyedegdyvv
    vkhaalfistvlskvlqlpnvklfnatcvedlvtrpptvagvvtnwtlvtqahgtcsmdp
    nvielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidnqklggmkgldmnha
    ehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqilkhfaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y4lC (C:)
    mgsshhhhhhssglvprgshmsatstatstsasqlhlnstpvthclsdivkkedwsdfkf
    apirestvsramtsryfkdldkfavsdviivgagssglsaayviaknrpdlkvciiessv
    apgggswlggqlfsamvmrkpahlflqeleipyedegdyvvvkhaalfistvlskvlqlp
    nvklfnatcvedlvtrpptekgevtvagvvtnwtlvtqahgtqcsmdpnvielagykndg
    trdlsqkhgvilsttghdgpfgafcakrivdidqnqklggmkgldmnhaehdvvihsgay
    agvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqilkhfaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4lC (C:)
    thclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgagssglsaay
    viaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipyedegdyvvv
    khaalfistvlskvlqlpnvklfnatcvedlvtrppgevtvagvvtnwtlvtqahgtcsm
    dpnvielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidqnqklggmkgldm
    nhaehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqilkhfa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y4lD (D:)
    mgsshhhhhhssglvprgshmsatstatstsasqlhlnstpvthclsdivkkedwsdfkf
    apirestvsramtsryfkdldkfavsdviivgagssglsaayviaknrpdlkvciiessv
    apgggswlggqlfsamvmrkpahlflqeleipyedegdyvvvkhaalfistvlskvlqlp
    nvklfnatcvedlvtrpptekgevtvagvvtnwtlvtqahgtqcsmdpnvielagykndg
    trdlsqkhgvilsttghdgpfgafcakrivdidqnqklggmkgldmnhaehdvvihsgay
    agvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqilkhfaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y4lD (D:)
    vthclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgagssglsaa
    yviaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipyedegdyvv
    vkhaalfistvlskvlqlpnvklfnatcvedlvtrpptekgevtvagvvtnwtlvtqahg
    tcsmdpnvielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidqnqklggmk
    gldmnhaehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqilk
    hfa