PDB entry 4y42

View 4y42 on RCSB PDB site
Description: Cyanase (CynS) from Serratia proteamaculans
Class: lyase
Keywords: CynS, cyanase, lyase
Deposited on 2015-02-10, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanate hydratase
    Species: Serratia proteamaculans [TaxId:399741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y42a1, d4y42a2
  • Chain 'B':
    Compound: cyanate hydratase
    Species: Serratia proteamaculans [TaxId:399741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y42b1, d4y42b2
  • Chain 'C':
    Compound: cyanate hydratase
    Species: Serratia proteamaculans [TaxId:399741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y42c1, d4y42c2
  • Chain 'D':
    Compound: cyanate hydratase
    Species: Serratia proteamaculans [TaxId:399741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y42d1, d4y42d2
  • Chain 'E':
    Compound: cyanate hydratase
    Species: Serratia proteamaculans [TaxId:399741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y42e1, d4y42e2
  • Chain 'F':
    Compound: cyanate hydratase
    Species: Serratia proteamaculans [TaxId:399741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y42f1, d4y42f2
  • Chain 'G':
    Compound: cyanate hydratase
    Species: Serratia proteamaculans [TaxId:399741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y42g1, d4y42g2
  • Chain 'H':
    Compound: cyanate hydratase
    Species: Serratia proteamaculans [TaxId:399741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y42h1, d4y42h2
  • Chain 'I':
    Compound: cyanate hydratase
    Species: Serratia proteamaculans [TaxId:399741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y42i1, d4y42i2
  • Chain 'J':
    Compound: cyanate hydratase
    Species: Serratia proteamaculans [TaxId:399741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y42j1, d4y42j2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y42A (A:)
    mtqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarv
    vaekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgi
    isainfkldikkvpdpdggeravitldgkylptkpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y42A (A:)
    tqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarvv
    aekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y42B (B:)
    mtqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarv
    vaekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgi
    isainfkldikkvpdpdggeravitldgkylptkpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y42B (B:)
    tqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarvv
    aekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y42C (C:)
    mtqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarv
    vaekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgi
    isainfkldikkvpdpdggeravitldgkylptkpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y42C (C:)
    tqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarvv
    aekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y42D (D:)
    mtqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarv
    vaekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgi
    isainfkldikkvpdpdggeravitldgkylptkpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y42D (D:)
    tqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarvv
    aekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4y42E (E:)
    mtqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarv
    vaekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgi
    isainfkldikkvpdpdggeravitldgkylptkpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y42E (E:)
    tqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarvv
    aekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4y42F (F:)
    mtqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarv
    vaekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgi
    isainfkldikkvpdpdggeravitldgkylptkpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y42F (F:)
    tqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarvv
    aekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4y42G (G:)
    mtqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarv
    vaekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgi
    isainfkldikkvpdpdggeravitldgkylptkpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y42G (G:)
    tqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarvv
    aekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4y42H (H:)
    mtqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarv
    vaekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgi
    isainfkldikkvpdpdggeravitldgkylptkpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y42H (H:)
    tqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarvv
    aekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4y42I (I:)
    mtqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarv
    vaekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgi
    isainfkldikkvpdpdggeravitldgkylptkpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y42I (I:)
    tqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarvv
    aekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4y42J (J:)
    mtqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarv
    vaekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgi
    isainfkldikkvpdpdggeravitldgkylptkpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y42J (J:)
    tqslhysspretltdtimmakirknltfeainqgtglslafvtaallgqhplpeqaarvv
    aekldldedairllqtiplrgsipggvptdptiyrfyemvqiygstlkalvheqfgdgii
    sainfkldikkvpdpdggeravitldgkylptkpf