PDB entry 4y31

View 4y31 on RCSB PDB site
Description: Crystal structure of yellow lupine LlPR-10.1A protein in ligand-free form
Class: plant protein
Keywords: pr-10 fold, ligand binding, phytohormone binding protein, trans-zeatin, cytokinin, plant protein
Deposited on 2015-02-10, released 2015-12-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein llr18a
    Species: Lupinus luteus [TaxId:3873]
    Gene: LLR18A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4y31a_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4y31A (A:)
gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd
ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh
tkgdvlsetvrdqakfkglglfkaiegyvlahpdy

    Sequence, based on observed residues (ATOM records): (download) 
    >4y31A (A:)
gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaiht
sfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfhtkg
dvlsetvrdqfkglglfkaiegyvlahpdy