PDB entry 4y2x

View 4y2x on RCSB PDB site
Description: Structure of soluble epoxide hydrolase in complex with 2-({[2-(adamantan-1-yl)ethyl]amino}methyl)phenol
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: hydrolase, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2015-02-10, released 2015-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional epoxide hydrolase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y2xa1, d4y2xa2
  • Heterogens: MG, 4A0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y2xA (A:)
    mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
    sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
    iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
    vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshg
    yvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygess
    appeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslnt
    pfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmh
    kvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwacksl
    grkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilik
    wldsdarnppvvskmhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y2xA (A:)
    tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
    qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
    ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
    flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshgy
    vtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygessa
    ppeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslntp
    fipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmhk
    vceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwackslg
    rkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilikw
    ldsdar