PDB entry 4y2b

View 4y2b on RCSB PDB site
Description: Co-crystal structure of 3-ethyl-2-(isopropylamino)-7-(pyridin-3-yl)thieno[3,2-d]pyrimidin-4(3H)-one bound to PDE7A
Class: hydrolase/hydrolase inhibitor
Keywords: phosphodiesterase, PDE7A, cAMP, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2015-02-09, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE7A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y2ba_
  • Heterogens: ZN, MG, EPK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y2bA (A:)
    gsgmketaaakferqhmdspdlgtddddkamadigssnslnildddyngqakcmlekvgn
    wnfdiflfdrltngnslvsltfhlfslhglieyfhldmmklrrflvmiqedyhsqnpyhn
    avhaadvtqamhcylkepklansvtpwdillsliaaathdldhpgvnqpfliktnhylat
    lykntsvlenhhwrsavgllresglfshlplesrqqmetqigalilatdisrqneylslf
    rshldrgdlcledtrhrhlvlqmalkcadicnpcrtwelskqwsekvteeffhqgdiekk
    yhlgvsplcdrhtesianiqigfmtylveplftewarfsntrlsqtmlghvglnkaswkg
    lqreqsssedtdaafelnsqllpqenrls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y2bA (A:)
    dyngqakcmlekvgnwnfdiflfdrltngnslvsltfhlfslhglieyfhldmmklrrfl
    vmiqedyhsqnpyhnavhaadvtqamhcylkepklansvtpwdillsliaaathdldhpg
    vnqpfliktnhylatlykntsvlenhhwrsavgllresglfshlplesrqqmetqigali
    latdisrqneylslfrshldrgdlcledtrhrhlvlqmalkcadicnpcrtwelskqwse
    kvteeffhqgdiekkyhlgvsplcdrhtesianiqigfmtylveplftewarfsntrlsq
    tmlghvglnkaswkglqr