PDB entry 4y28

View 4y28 on RCSB PDB site
Description: The structure of plant photosystem I super-complex at 2.8 angstrom resolution.
Class: photosynthesis
Keywords: photosynthesis, light harvesting, antenna, reaction center
Deposited on 2015-02-09, released 2015-08-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Light-harvesting complex I chlorophyll A/B-binding protein
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y28
  • Chain '2':
    Compound: Type II chlorophyll a/b binding protein from photosystem I
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41038
      • engineered mutation (132)
    Domains in SCOPe 2.05: d4y282_
  • Chain '3':
    Compound: Chlorophyll a-b binding protein 3, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: chlorophyll a-b binding protein p4, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SQL2
      • engineered mutation (127)
  • Chain 'A':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05310 (Start-757)
      • engineered mutation (20-21)
      • engineered mutation (116)
      • engineered mutation (219)
    Domains in SCOPe 2.05: d4y28a_
  • Chain 'B':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05311 (Start-732)
      • engineered mutation (4)
      • engineered mutation (114)
      • engineered mutation (272)
      • engineered mutation (470)
      • engineered mutation (475-476)
      • engineered mutation (634)
    Domains in SCOPe 2.05: d4y28b_
  • Chain 'C':
    Compound: photosystem I iron-sulfur center
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4y28c_
  • Chain 'D':
    Compound: photosystem I reaction center subunit II, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y28 (Start-140)
    Domains in SCOPe 2.05: d4y28d_
  • Chain 'E':
    Compound: photosystem I reaction center subunit IV a, chloroplastic
    Species: Pisum sativum [TaxId:4096]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y28 (0-65)
    Domains in SCOPe 2.05: d4y28e_
  • Chain 'F':
    Compound: Photosystem I reaction center subunit III
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y28
    Domains in SCOPe 2.05: d4y28f_
  • Chain 'G':
    Compound: photosystem I reaction center
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y28
  • Chain 'H':
    Compound: Photosystem I reaction center subunit VI
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y28 (Start-83)
  • Chain 'I':
    Compound: Photosystem I reaction center subunit VIII
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Photosystem I reaction center subunit IX
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4y28j_
  • Chain 'K':
    Compound: Photosystem I reaction center subunit X psaK
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y28 (Start-78)
  • Chain 'L':
    Compound: Putative uncharacterized protein
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y28 (Start-166)
  • Heterogens: CL0, CLA, SF4, PQN, LHG, BCR, LMG, CA, DGD, LMU, LUT, CHL, ZEX

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >4y282 (2:)
    masacassaiaavaistpssqkngspsgtskaflgrklkvnsstaspsrvrststvctva
    epdrplwfpgstpppwldgslpgdfgfdplglgsdpeslrwnvqaelvhsrwamlgaagi
    fipefltklgilltpswytageqeyftdtttlfivelvfigwaegrrwadilnpgcvntd
    pifpnnkltgtdvgypgglwfdplgwgsaspqklkelrtkeikngrlamlavmgawfqhi
    ytgtgpidnlfahladpghatifaaftpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y282 (2:)
    vaepdrplwfpgstpppwldgslpgdfgfdplglgsdpeslrwnvqaelvhsrwamlgaa
    gifipefltklgilltpswytageqeyftdtttlfivelvfigwaegrrwadilnpgcvn
    tdpifpnnkltgtdvgypgglwfdplgwgsaspqklkelrtkeikngrlamlavmgawfq
    hiytgtgpidnlfahladpghatifaa
    

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y28A (A:)
    miirspepkvqiladpevkiildrdpiktsfeqwakpghfsrtiakgpdtttwiwnlhad
    ahdfdshtsdleeisrkvfsahfgqlsiiflwlsgmyfhgarfsnyeawlndpthirpsa
    qvvwpivgqeilngdvgggfrgiqitsgffqiwrasgitselqlyctaigalvfaglmlf
    agwfhyhkaapklawfqdvesmlnhhlagllglgslswaghqvhvslpinqflnagvdpk
    eiplphefilnrdllaqlypsfaegatpfftlnwskyadfltfrggldpltgglwltdia
    hhhlaiailfliaghmyrtnwgighgikdileahkgpftgqghkglyeilttswhaqlsi
    nlamlgsltivvaqhmysmppypylatdyatqlslfthhmwiggflivgaaahaaifmvr
    dydpttryndlldrvlrhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdt
    aiqlqpvfaqwiqnthalapgttapgatastsltwgggdlvavgnkvallpiplgtadfl
    vhhihaftihvtvlillkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvfl
    glfwmynsisvvifhfswkmqsdvwgtindqgvvthittgnfaqssitingwlrdflwaq
    asqviqsygsslsayglfflgahfvwafslmflfsgrgywqeliesivwahnklkvapat
    qpralsivqgravgvthyllggiattwafflariiavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y28A (A:)
    evkiildrdpiktsfeqwakpghfsrtiakgpdtttwiwnlhadahdfdshtsdleeisr
    kvfsahfgqlsiiflwlsgmyfhgarfsnyeawlndpthirpsaqvvwpivgqeilngdv
    gggfrgiqitsgffqiwrasgitselqlyctaigalvfaglmlfagwfhyhkaapklawf
    qdvesmlnhhlagllglgslswaghqvhvslpinqflnagvdpkeiplphefilnrdlla
    qlypsfaegatpfftlnwskyadfltfrggldpltgglwltdiahhhlaiailfliaghm
    yrtnwgighgikdileahkgpftgqghkglyeilttswhaqlsinlamlgsltivvaqhm
    ysmppypylatdyatqlslfthhmwiggflivgaaahaaifmvrdydpttryndlldrvl
    rhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnth
    alapgttapgatastsltwgggdlvavgnkvallpiplgtadflvhhihaftihvtvlil
    lkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmynsisvvifhf
    swkmqsdvwgtindqgvvthittgnfaqssitingwlrdflwaqasqviqsygsslsayg
    lfflgahfvwafslmflfsgrgywqeliesivwahnklkvapatqpralsivqgravgvt
    hyllggiattwafflariiavg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y28B (B:)
    malrlprfsqgiaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflw
    tsgnlfhvawqgnfeawvqdpfhvrpiahaiwdphfgqpaveaftrggalgpvniaysgv
    yqwwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhls
    glfgvsslawaghlvhvaipgsrgeyvrwnnfldvlpypqglgplltgqwnlyaqnpsss
    nhlfgttqgagtailtilggfhpqtqslwltdmahhhlaiaflfligglmyrtnfgighs
    ikyileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayaf
    iaqdfttqaalythhqyiagfimtgafahgpiffirdynpeqnadnvlarmlehkeaiis
    hlswaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgktsygfdvllss
    tngpalnagrniwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgald
    argsklmpdkkdfgysfpcdgpgrggtcdisawddfylavfwmlntigwvtfywhwkhit
    lwrgnvsqfnesstylmgwlrdylwlnssqlingytplvcnslsvwawmflfghlvwatg
    fmfliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyift
    yaafliastsgkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y28B (B:)
    alrlprfsqgiaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflwt
    sgnlfhvawqgnfeawvqdpfhvrpiahaiwdphfgqpaveaftrggalgpvniaysgvy
    qwwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhlsg
    lfgvsslawaghlvhvaipgsrgeyvrwnnfldvlpypqglgplltgqwnlyaqnpsssn
    hlfgttqgagtailtilggfhpqtqslwltdmahhhlaiaflfligglmyrtnfgighsi
    kyileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayafi
    aqdfttqaalythhqyiagfimtgafahgpiffirdynpeqnadnvlarmlehkeaiish
    lswaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgktsygfdvllsst
    ngpalnagrniwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgalda
    rgsklmpdkkdfgysfpcdgpgrggtcdisawddfylavfwmlntigwvtfywhwkhitl
    wrgnvsqfnesstylmgwlrdylwlnssqlingytplvcnslsvwawmflfghlvwatgf
    mfliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyifty
    aafliastsgkf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y28C (C:)
    mshsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacpt
    dflsvrvylwhettrsmglay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y28C (C:)
    shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
    flsvrvylwhettrsmglay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y28D (D:)
    keapvgtppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimr
    egpnllklarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqg
    vgvnfrsigknvspievkftgkqpydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y28D (D:)
    tppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpnll
    klarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvnfr
    sigknvspievkftgkqpydl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4y28E (E:)
    ppigpkrgakvkilrqesywykgtgsvvtvdqdpntrypvvvrfnkvnyanvstnnyald
    eveevk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4y28F (F:)
    disgltpckeskqfakrekqsikklesslkiyaadsapalainatiektkrrfdnyakqg
    llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairdekkptqkeii
    idvplasrlvfrgfswpiaayrellngelvakdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y28F (F:)
    sgltpckeskqfakrekqsikklesslkiyaadsapalainatiektkrrfdnyakqgll
    cgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairdekkptqkeiiid
    vplasrlvfrgfswpiaayrellngelvak
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4y28J (J:)
    mrdlktylsvapvastlwfaalagllieinrlfpdaltfpff
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y28J (J:)
    rdlktylsvapvastlwfaalagllieinrlfpdaltfpff
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.