PDB entry 4y26

View 4y26 on RCSB PDB site
Description: Complex of human Galectin-7 and Galbeta1-3(6OSO3)GlcNAc
Class: sugar binding protein
Keywords: Complex, Galectin-7, sulfated LacNAc, Galbeta1-3(6OSO3)GlcNAc, SUGAR BINDING PROTEIN
Deposited on 2015-02-09, released 2016-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-7
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS7, PIG1, LGALS7B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4y26a_
  • Chain 'B':
    Compound: galectin-7
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS7, PIG1, LGALS7B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4y26b_
  • Heterogens: GAL, 6S2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y26A (A:)
    mgsshhhhhhssglvprgshmvphksslpegirpgtvlrirglvppnasrfhvnllcgee
    qgsdaalhfnprldtsevvfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavv
    gdaqyhhfrhrlplarvrlvevggdvqldsvrif
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y26A (A:)
    vphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfn
    skeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlve
    vggdvqldsvrif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y26B (B:)
    mgsshhhhhhssglvprgshmvphksslpegirpgtvlrirglvppnasrfhvnllcgee
    qgsdaalhfnprldtsevvfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavv
    gdaqyhhfrhrlplarvrlvevggdvqldsvrif
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y26B (B:)
    vphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfn
    skeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlve
    vggdvqldsvrif