PDB entry 4y0n

View 4y0n on RCSB PDB site
Description: sav1875
Class: hydrolase
Keywords: dj-1/pfpi/thij family, hydrolase
Deposited on 2015-02-06, released 2016-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-06, with a file datestamp of 2015-12-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein SAV1875
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Gene: SAV1875
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K0 (Start-170)
      • expression tag (171)
    Domains in SCOPe 2.07: d4y0na1, d4y0na2
  • Chain 'B':
    Compound: Uncharacterized protein SAV1875
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Gene: SAV1875
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K0 (Start-170)
      • expression tag (171-176)
    Domains in SCOPe 2.07: d4y0nb1, d4y0nb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y0nA (A:)
    mtkkvaiilanefedieysspkealenagfntvvigdtansevvgkhgekvtvdvgiaea
    kpedydallipggfspdhlrgdtegrygtfakyftkndvptfaichgpqilidtddlkgr
    tltavlnvrkdlsnagahvvdesvvvdnnivtsrvpddlddfnreivkqlqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y0nA (A:)
    tkkvaiilanefedieysspkealenagfntvvigdtansevvgkhgekvtvdvgiaeak
    pedydallipggfspdhlrgdtegrygtfakyftkndvptfaichgpqilidtddlkgrt
    ltavlnvrkdlsnagahvvdesvvvdnnivtsrvpddlddfnreivkqlql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y0nB (B:)
    mtkkvaiilanefedieysspkealenagfntvvigdtansevvgkhgekvtvdvgiaea
    kpedydallipggfspdhlrgdtegrygtfakyftkndvptfaichgpqilidtddlkgr
    tltavlnvrkdlsnagahvvdesvvvdnnivtsrvpddlddfnreivkqlqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y0nB (B:)
    tkkvaiilanefedieysspkealenagfntvvigdtansevvgkhgekvtvdvgiaeak
    pedydallipggfspdhlrgdtegrygtfakyftkndvptfaichgpqilidtddlkgrt
    ltavlnvrkdlsnagahvvdesvvvdnnivtsrvpddlddfnreivkqlqlehhhh