PDB entry 4y0g

View 4y0g on RCSB PDB site
Description: beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK)
Class: protein binding
Keywords: carbohydrate binding module, AMPK
Deposited on 2015-02-06, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y0ga_
  • Chain 'B':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZH4 (8-89)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d4y0gb1, d4y0gb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y0gA (A:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y0gA (A:)
    qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv
    hdpsepvvtsqlgtinnlihvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y0gB (B:)
    gplgspnsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqyk
    ffvdgqwvhdpsepvvtsqlgtinnlihvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y0gB (B:)
    nsqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgq
    wvhdpsepvvtsqlgtinnlihvk