PDB entry 4xzp

View 4xzp on RCSB PDB site
Description: Crystal structure of the N-terminal domain of human galectin-4
Class: sugar binding protein
Keywords: galectins, beta-galactosides binding, SUGAR BINDING PROTEIN
Deposited on 2015-02-04, released 2016-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xzpa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xzpA (A:)
    mgsshhhhhhssglvprgshmayvpapgyqptynptlpyyqpipgglnvgmsvyiqgvas
    ehmkrffvnfvvgqdpgsdvafhfnprfdgwdkvvfntlqggkwgseerkrsmpfkkgaa
    felvfivlaehykvvvngnpfyeyghrlplqmvthlqvdgdlqlqsinfigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xzpA (A:)
    papgyqptynptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdvafhf
    nprfdgwdkvvfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnpfyey
    ghrlplqmvthlqvdgdlqlqsinfigg