PDB entry 4xz5

View 4xz5 on RCSB PDB site
Description: Structure of the thermostable alpha-Carbonic Anydrase from Thiomicrospira crunogena XCL-2 gammaproteobacterium
Class: lyase
Keywords: Carbonic Anhydrase, Thiomicrospira crunogena XCL-2, thermostability, CO2 sequestration, LYASE
Deposited on 2015-02-03, released 2015-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase, alpha family
    Species: Thiomicrospira crunogena (strain XCL-2) [TaxId:317025]
    Gene: Tcr_1545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xz5a_
  • Chain 'B':
    Compound: Carbonic anhydrase, alpha family
    Species: Thiomicrospira crunogena (strain XCL-2) [TaxId:317025]
    Gene: Tcr_1545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xz5b_
  • Chain 'C':
    Compound: Carbonic anhydrase, alpha family
    Species: Thiomicrospira crunogena (strain XCL-2) [TaxId:317025]
    Gene: Tcr_1545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xz5c_
  • Chain 'D':
    Compound: Carbonic anhydrase, alpha family
    Species: Thiomicrospira crunogena (strain XCL-2) [TaxId:317025]
    Gene: Tcr_1545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xz5d_
  • Heterogens: ZN, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xz5A (A:)
    pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk
    linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl
    aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp
    pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpdrna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xz5A (A:)
    pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk
    linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl
    aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp
    pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xz5B (B:)
    pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk
    linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl
    aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp
    pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpdrna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xz5B (B:)
    pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk
    linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl
    aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp
    pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xz5C (C:)
    pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk
    linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl
    aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp
    pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpdrna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xz5C (C:)
    pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk
    linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl
    aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp
    pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xz5D (D:)
    pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk
    linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl
    aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp
    pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpdrna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xz5D (D:)
    pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk
    linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl
    aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp
    pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpd